.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sfr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mycobacterium tuberculosis Antigen 85A and 85C Structures Confirm Binding Orientation and Conserved Substrate Specificity. J.Biol.Chem. 279 36771-36777 2004
    Site TBSGC
    PDB Id 1sfr Target Id Rv3804c
    Molecular Characteristics
    Source
    Alias Ids TPS20795,15610940, P0A4V2, 15610940, NP_218321.1 Molecular Weight 35684.32 Da.
    Residues 338 Isoelectric Point 6.08
    Sequence mqlvdrvrgavtgmsrrlvvgavgaalvsglvgavggtatagafsrpglpveylqvpspsmgrdikvqf qsgganspalylldglraqddfsgwdintpafewydqsglsvvmpvggqssfysdwyqpacgkagcqty kwetfltselpgwlqanrhvkptgsavvglsmaassaltlaiyhpqqfvyagamsglldpsqamgptli glamgdaggykasdmwgpkedpawqrndpllnvgklianntrvwvycgngkpsdlggnnlpakflegfv rtsnikfqdaynaggghngvfdfpdsgthsweywgaqlnamkpdlqralgatpntgpapqga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.70 Rfree 0.254
    Matthews' coefficent 5.23 Rfactor 0.222
    Waters 58 Solvent Content 76.31

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1sfr

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch