.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rwl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Sensor Domain of the Mycobacterium tuberculosis Receptor Ser/Thr Protein Kinase, PknD, forms a Highly Symmetric beta Propeller. J.Mol.Biol. 339 459-469 2004
    Site TBSGC
    PDB Id 1rwl Target Id Rv0931c
    Related PDB Ids 1rwi 
    Molecular Characteristics
    Source
    Alias Ids TPS9445,15608071, O05871, 15608071, O05871, NP_215446.1 Molecular Weight 69541.38 Da.
    Residues 664 Isoelectric Point 5.53
    Sequence msdavpqvgsqfgpyqllrllgrggmgevyeaedtrkhrvvalklispqysdnavfrarmqreadtagr ltephivpihdygeingqffvemrmidgtslrallkqygpltparavaivrqiaaaldaahangvthrd vkpenilvtasdfaylvdfgiaraasdpgltqtgtavgtynymaperftgdevtyradiyalacvlgec ltgappyradsverliaahlmdpapqpsqlrpgrvppaldqviakgmaknpaerfmsagdlaiaahdal ttseqhqattilrrgdnatllatpadtglsqsesgiagagtgpptpgaarwspgdsatvagplaadsrg gnwpsqtghspavpnalqaslghavppagnkrkvwavvgaaaivlvaivaaagylvlrpswsptqasgq tvlpftgidfrlspsgvavdsagnvyvtsegmygrvvklatgstgttvlpfnglyqpqglavdgagtvy vtdfnnrvvtlaagsnnqtvlpfdglnypeglavdtqgavyvadrgnnrvvklaagsktqtvlpftgln dpdgvavdnsgnvyvtdtdnnrvvkleaesnnqvvlpftditapwgiavdeagtvyvtehntnqvvkll agsttstvlpftglntplavavdsdrtvyvadrgndrvvklts
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.262
    Matthews' coefficent 5.62 Rfactor 0.214
    Waters 70 Solvent Content 77.96

    Ligand Information
    Ligands
    Metals CD (CADMIUM) x 4

    Jmol

     
    Google Scholar output for 1rwl

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch