.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rfe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The SAD crystal structure of Mycobacterium tuberculosis conserved hypotetical protein Rv2991. To be Published
    Site TBSGC
    PDB Id 1rfe Target Id Rv2991
    Molecular Characteristics
    Source
    Alias Ids TPS20713,15610128, O53240, 15610128, NP_217507.1 Molecular Weight 18202.75 Da.
    Residues 163 Isoelectric Point 6.09
    Sequence mgtkqradivmseaeiadfvnssrtgtlatigpdgqphltamwyavidgeiwletkaksqkavnlrrdp rvsflledgdtydtlrgvsfegvaeiveepealhrvgvsvwerytgpytdeckpmvdqmmnkrvgvriv arrtrswdhrklglphmsvggstap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.28106
    Matthews' coefficent 2.20 Rfactor 0.20213
    Waters 125 Solvent Content 44.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1rfe

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch