The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of quinolinic acid phosphoribosyltransferase from Mycobacterium tuberculosis: a potential TB drug target. Structure 6 1587-1599 1998
    Site TBSGC
    PDB Id 1qpq Target Id Rv1596
    Related PDB Ids 1qpn 1qpo 1qpr 
    Molecular Characteristics
    Alias Ids TPS9465,15608734, O06594, 15608734, O06594, NP_216112.1 Molecular Weight 29949.37 Da.
    Residues 285 Isoelectric Point 5.09
    Sequence mglsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvalltlnevlgt ngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatataawvdavrgtkakirdt rktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaagsvvdalravrnaapdlpcevevdsleq ldavlpekpelilldnfavwqtqtavqrrdsraptvmlessgglslqtaatyaetgvdylavgalthsv rvldigldm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.45 Rfree 0.2530000
    Matthews' coefficent 2.36 Rfactor 0.1780000
    Waters 266 Solvent Content 47.94

    Ligand Information
    Ligands SO4 (SULFATE) x 6;NTM (QUINOLINIC) x 6


    Google Scholar output for 1qpq

    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch