.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nyo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. J.Biol.Chem. 278 43736-43743 2003
    Site TBSGC
    PDB Id 1nyo Target Id Rv2875
    Molecular Characteristics
    Source
    Alias Ids TPS20709,15610012, P0A668, 15610012, NP_217391.1 Molecular Weight 19071.42 Da.
    Residues 193 Isoelectric Point 4.75
    Sequence mkvkntiaatsfaaaglaalavavsppaaagdlvgpgcaeyaaanptgpasvqgmsqdpvavaasnnpe lttltaalsgqlnpqvnlvdtlnsgqytvfaptnaafsklpastidelktnsslltsiltyhvvagqts panvvgtrqtlqgasvtvtgqgnslkvgnadvvcggvstanatvymidsvlmppa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nyo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch