The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Gram-positive DsbE Proteins Function Differently from Gram-negative DsbE Homologs: A STRUCTURE TO FUNCTION ANALYSIS OF DsbE FROM MYCOBACTERIUM TUBERCULOSIS. J.Biol.Chem. 279 3516-3524 2004
    Site TBSGC
    PDB Id 1lu4 Target Id Rv2878c
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20711, Molecular Weight 18025.49 Da.
    Residues 170 Isoelectric Point 5.19
    Sequence slrlvspikafadgivavaiavvlmfglantpravaaderlqftattlsgapfdgaslqgkpavlwfwtp wcpfcnaeaslsqvaaanpavtfvgiatradvgamqsfvskynlnftnlndadgviwarynvpwqpafv fyradgtstfvnnptaamsdelsgrvaalts
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.12 Rfree 0.2158
    Matthews' coefficent 2.18 Rfactor 0.1523
    Waters 321 Solvent Content 43.60

    Ligand Information


    Google Scholar output for 1lu4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch