.
The Open Protein Structure Annotation Network
PDB Keyword
.

1l1e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis. J.Biol.Chem. 277 11559-11569 2002
    Site TBSGC
    PDB Id 1l1e Target Id Rv0470c
    Molecular Characteristics
    Source
    Alias Ids TPS9436,57116736, Q7D9R5, 57116736, YP_177730.1 Molecular Weight 33026.07 Da.
    Residues 287 Isoelectric Point 6.00
    Sequence msvqltphfgnvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklnlepgmtll digcgwgatmrraiekydvnvvgltlsenqaghvqkmfdqmdtprsrrvllegwekfdepvdrivsiga fehfghqryhhffevthrtlpadgkmllhtivrptfkegrekgltlthelvhftkfilaeifpggwlps iptvheyaekvgfrvtavqslqlhyartldmwataleankdqaiaiqsqtvydrymkyltgcaklfrqg ytdvdqftlek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.27
    Matthews' coefficent 2.00 Rfactor 0.222
    Waters 200 Solvent Content 38.53

    Ligand Information
    Ligands CO3 (CARBONATE) x 2;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1l1e

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch