The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis. J.Biol.Chem. 277 11559-11569 2002
    Site TBSGC
    PDB Id 1kpi Target Id Rv0503c
    Molecular Characteristics
    Alias Ids TPS9437,15607644, P0A5P0, 15607644, NP_215017.1 Molecular Weight 34658.29 Da.
    Residues 302 Isoelectric Point 5.11
    Sequence mtsqgdttsgtqlkppveavrshydksneffklwldpsmtyscayferpdmtleeaqyakrklaldkln lepgmtlldigcgwgstmrhavaeydvnvigltlsenqyahdkamfdevdsprrkevriqgweefdepv drivslgafehfadgagdagferydtffkkfynltpddgrmllhtitipdkeeaqelgltspmsllrfi kfilteifpggrlprisqvdyyssnagwkveryhriganyvptlnawadalqahkdeaialkgqetydi ymhylrgcsdlfrdkytdvcqftlvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.65 Rfree 0.242
    Matthews' coefficent 4.67 Rfactor 0.208
    Waters 62 Solvent Content 73.68

    Ligand Information


    Google Scholar output for 1kpi

    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch