.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kph

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis. J.Biol.Chem. 277 11559-11569 2002
    Site TBSGC
    PDB Id 1kph Target Id Rv3392c
    Related PDB Ids 1kp9 1kpg 
    Molecular Characteristics
    Source
    Alias Ids TPS20719,15610528, Q11195, 15610528, Q11195, NP_217909.1 Molecular Weight 32459.55 Da.
    Residues 287 Isoelectric Point 5.80
    Sequence mpdelkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqpgmtll dvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagweqfdepvdrivsiga fehfgherydaffslahrllpadgvmllhtitglhpkeiherglpmsftfarflkfivteifpggrlps ipmvqecasangftvtrvqslqphyaktldlwsaalqankgqaialqseevyerymkyltgcaemfrig yidvnqftcqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.24
    Matthews' coefficent 2.03 Rfactor 0.194
    Waters 732 Solvent Content 39.30

    Ligand Information
    Ligands CO3 (CARBONATE) x 4;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 4;10A (DIDECYL-DIMETHYL-AMMONIUM) x 4
    Metals

    Jmol

     
    Google Scholar output for 1kph

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch