.
The Open Protein Structure Annotation Network
PDB Keyword
.

1k44

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Mycobacterium tuberculosis nucleoside diphosphate kinase. Proteins 47 556-557 2002
    Site TBSGC
    PDB Id 1k44 Target Id Rv2445c
    Molecular Characteristics
    Source
    Alias Ids TPS27507,15609582, P84284, 15609582, P71904, NP_216961.1 Molecular Weight 14506.70 Da.
    Residues 136 Isoelectric Point 5.34
    Sequence mtertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgsllefitsg pvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsdsaesaqreialwfpga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.60 Rfree 0.2460000
    Matthews' coefficent 2.78 Rfactor 0.2050000
    Waters 107 Solvent Content 55.82

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1k44

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch