.
The Open Protein Structure Annotation Network
PDB Keyword
.

1gr0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Inositol 1-Phosphate Synthase from Mycobacterium Tuberculosis, a Key Enzyme in Phosphatidylinositol Synthesis. Structure 10 393 2002
    Site TBSGC
    PDB Id 1gr0 Target Id Rv0046c
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS27417,15607188, P71703, 15607188, NP_214560.1 Molecular Weight 40091.42 Da.
    Residues 367 Isoelectric Point 5.02
    Sequence msehqslpapeastevrvaivgvgncasslvqgveyyynaddtstvpglmhvrfgpyhvrdvkfvaafd vdakkvgfdlsdaifasenntikiadvaptnvivqrgptldgigkyyadtielsdaepvdvvqalkeak vdvlvsylpvgseeadkfyaqcaidagvafvnalpvfiasdpvwakkftdarvpivgddiksqvgatit hrvlaklfedrgvqldrtmqlnvggnmdflnmlererleskkisktqavtsnlkrefktkdvhigpsdh vgwlddrkwayvrlegrafgdvplnleyklevwdspnsagviidavraakiakdrgiggpvipasaylm ksppeqlpddiaraqleefiig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.239
    Matthews' coefficent 2.8 Rfactor 0.211
    Waters 170 Solvent Content 56

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 1;CAC (CACODYLATE) x 1
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1gr0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch