.
The Open Protein Structure Annotation Network
PDB Keyword
.

1f0n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title An interfacial mechanism and a class of inhibitors inferred from two crystal structures of the Mycobacterium tuberculosis 30 kDa major secretory protein (Antigen 85B), a mycolyl transferase. J.Mol.Biol. 307 671-681 2001
    Site TBSGC
    PDB Id 1f0n Target Id Rv1886c
    Related PDB Ids 1f0p 
    Molecular Characteristics
    Source
    Alias Ids TPS20649,15609023, P31952, 15609023, NP_216402.1 Molecular Weight 34578.97 Da.
    Residues 325 Isoelectric Point 5.62
    Sequence mtdvsrkirawgrrlmigtaaavvlpglvglaggaatagafsrpglpveylqvpspsmgrdikvqfqsg gnnspavylldglraqddyngwdintpafewyyqsglsivmpvggqssfysdwyspacgkagcqtykwe tfltselpqwlsanravkptgsaaiglsmagssamilaayhpqqfiyagslsalldpsqgmgpsligla mgdaggykaadmwgpssdpawerndptqqipklvanntrlwvycgngtpnelgganipaeflenfvrss nlkfqdaynaagghnavfnfppngthsweywgaqlnamkgdlqsslgag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.276
    Matthews' coefficent 2.33 Rfactor 0.1941
    Waters 205 Solvent Content 46.90

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 1;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 3
    Metals

    Jmol

     
    Google Scholar output for 1f0n

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch