The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Mycobacterium tuberculosis 7,8-dihydropteroate synthase in complex with pterin monophosphate: new insight into the enzymatic mechanism and sulfa-drug action. J.Mol.Biol. 302 1193-1212 2000
    Site TBSGC
    PDB Id 1eye Target Id Rv3608c
    Molecular Characteristics
    Alias Ids TPS27504,57117134, P0A578, 57117134, YP_177997.1 Molecular Weight 28841.29 Da.
    Residues 280 Isoelectric Point 5.08
    Sequence mspapvqvmgvlnvtddsfsdggcyldlddavkhglamaaagagivdvggessrpgatrvdpavetsrv ipvvkelaaqgitvsidtmradvaraalqngaqmvndvsggradpamgpllaeadvpwvlmhwravsad tphvpvrygnvvaevradllasvadavaagvdparlvldpglgfaktaqhnwailhalpelvatgipvl vgasrkrflgallagpdgvmrptdgrdtatavisalaalhgawgvrvhdvrasvdaikvveawmgaeri erdg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.2430000
    Matthews' coefficent 2.40 Rfactor 0.1850000
    Waters 244 Solvent Content 48.74

    Ligand Information
    Metals MG (MAGNESIUM) x 1


    Google Scholar output for 1eye

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch