The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat.Struct.Biol. 7 141-146 2000
    Site TBSGC
    PDB Id 1dqz Target Id Rv0129c
    Related PDB Ids 1dqy 1va5 
    Molecular Characteristics
    Alias Ids TPS9426,57116693, P0A4V4, 57116693, YP_177694.1 Molecular Weight 36769.33 Da.
    Residues 340 Isoelectric Point 5.92
    Sequence mtffeqvrrlrsaattlprrlaiaamgavlvyglvgtfggpatagafsrpglpveylqvpsasmgrdik vqfqgggphavylldglraqddyngwdintpafeeyyqsglsvimpvggqssfytdwyqpsqsngqnyt ykwetfltrempawlqankgvsptgnaavglsmsggsalilaayypqqfpyaaslsgflnpsegwwptl iglamndsggynansmwgpssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegl tlrtnqtfrdtyaadggrngvfnfppngthswpywneqlvamkadiqhvlngatppaapaapaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.1853
    Matthews' coefficent 2.86 Rfactor 0.1665
    Waters 581 Solvent Content 57.04

    Ligand Information


    Google Scholar output for 1dqz

    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch