.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lg6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative glutathione transferase from Coccidioides immitis. To be Published
    Site SSGCID
    PDB Id 3lg6 Target Id CoimA.00410.a
    Molecular Characteristics
    Source Coccidioides immitis
    Alias Ids TPS33499, Molecular Weight 25583.97 Da.
    Residues 231 Isoelectric Point 6.96
    Sequence mttpnfelygyfrsscsgrlriafhlksipytrhpvnllkgeqhsdtykslnptntvpllvvsninntv spssasfsigqslaaleyleealptnarpllppisnpvarahvrticniiacdvqpvtnlkiqkkvkal dgdptvwsrdlatqgfgavekllelsagrfcvgdeitladvclvpavwaaervgmdlarfpitkrvfee mlkeeavqkahwqkqedtpedlra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.226
    Matthews' coefficent 2.29 Rfactor 0.171
    Waters 590 Solvent Content 46.34

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3lg6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch