.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kc6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the large c-terminal domain of polymerase basic protein 2 from influenza virus a/viet nam/1203/2004 (h5n1). To be published
    Site SSGCID
    PDB Id 3kc6 Target Id InvaA.07055.a
    Molecular Characteristics
    Source Influenza a virus (a/viet nam/1203/2004 (h5n1))
    Alias Ids TPS31932, Molecular Weight 85795.75 Da.
    Residues 759 Isoelectric Point 9.54
    Sequence merikelrdlmsqsrtreiltkttvdhmaiikkytsgrqeknpalrmkwmmamkypitadkriiemipe rneqgqtlwsktndagsdrvmvsplavtwwnrngpatsavhypkvyktyfekverlkhgtfgpvhfrnq vkirrrvdinpghadlsakeaqdvimevvfpnevgariltsesqltitkekkeelqdckiaplmvayml erelvrktrflpvaggtssvyievlhltqgtcweqmytpggevrnddvdqsliiaarnivrratvsadp lasllemchstqiggirmvdilrqnpteeqavdickaamglrisssfsfggftfkrtsgssvkkeeevl tgnlqtlkirvhegyeeftmvgrratailrkatrrliqlivsgrdqqsiaeaiivamvfsqedcmikav rgdlnfvnranqrlnpmhqllrhfqkdakvlfqnwgiepidnvmgmigilpdmtpstemslrgvrvskm gvdeysstervvvsidrflrvrdqrgnvllspeevsetqgtekltitysssmmweingpesvlvntyqw iirnwetvkiqwsqdptmlynkmefepfqslvpkaargqysgfvrtlfqqmrdvlgtfdtvqiikllpf aaappkqsrmqfssltvnvrgsgmrilvrgnspvfnynkatkrltvlgkdagaltedpdegtagvesav lrgflilgkedkrygpalsinelsnlakgekanvligqgdvvlvmkrkrdssiltdsqtatkrirmain
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.245
    Matthews' coefficent 2.31 Rfactor 0.202
    Waters 92 Solvent Content 46.79

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 3
    Metals

    Jmol

     
    Google Scholar output for 3kc6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch