.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k2c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of peptidyl-prolyl cis-trans isomerase from Encephalitozoon cuniculi at 1.9 A resolution. To be published
    Site SSGCID
    PDB Id 3k2c Target Id EncuA.00682.a
    Molecular Characteristics
    Source Encephalitozoon cuniculi
    Alias Ids TPS31931, Molecular Weight 19045.62 Da.
    Residues 172 Isoelectric Point 6.59
    Sequence makeasgnvyfdvyaneeslgrivmkleddivpktaknfrtlcerpkgegykgstfhriipgfmvqggdy tahngtggrsiygekfpdenfelkhtkegilsmancgahtngsqffitlgktqwldekhvvfgevvegm dvvhkiakygsesgqvkkgyrieirdcgvlgsn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.216
    Matthews' coefficent 2.09 Rfactor 0.163
    Waters 438 Solvent Content 41.28

    Ligand Information
    Ligands PG5 (1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE) x 2;EDO (1,2-ETHANEDIOL) x 2;SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3k2c

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch