.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dmo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.6 A crystal structure of cytidine deaminase from Burkholderia pseudomallei. To be Published
    Site NON-SSGCID
    PDB Id 3dmo Target Id BupsA.00001.a
    Molecular Characteristics
    Source Burkholderia pseudomallei
    Alias Ids TPS14936, CDD, BPSS1959 Molecular Weight 13628.84 Da.
    Residues 130 Isoelectric Point 6.04
    Sequence MTHHALIEAAKAAREKAYAPYSNFKVGAALVTNDGKVFHGCNVENASYGLCNCAERTALFSALAAGYRPGEFAAIA VVGETHGPIAPCGACRQVMIELGKPTLEVVLTNMQGDVRVTSAGDLLPDAFYLA
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.60 Rfree 0.224
    Matthews' coefficent 2.89 Rfactor 0.199
    Waters 362 Solvent Content 57.48

    Ligand Information
    Ligands MRD ((4R)-2-METHYLPENTANE-2,4-DIOL) x 4;PO4 (PHOSPHATE) x 1
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 3dmo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch