.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dah

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.3 A crystal structure of ribose-phosphate pyrophosphokinase from Burkholderia pseudomallei. To be Published
    Site NON-SSGCID
    PDB Id 3dah Target Id BupsA.00035.a
    Molecular Characteristics
    Source Burkholderia pseudomallei
    Alias Ids TPS14934, PRSA, BURPS1710B_0753 Molecular Weight 34208.69 Da.
    Residues 318 Isoelectric Point 6.01
    Sequence MSSHDGLMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQVEIQENVRGKDVFVLQSTCAPTNDNLMELMIM VDALKRASAGRITAAIPYFGYARQDRRPRSARVAISAKVVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYA TPILLGDLRKQNYPDLLVVSPDVGGVVRARALAKQLNCDLAIIDKRRPKANVAEVMNIIGEVEGRTCVIMDDMVD TAGTLCKAAQVLKERGAKQVFAYATHPVLSGGAADRIAASALDELVVTDTIPLSAESLACPKIRALSSAGLLAET FSRIRRGDSVMSLFAES
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.255
    Matthews' coefficent 2.30 Rfactor 0.206
    Waters 138 Solvent Content 46.55

    Ligand Information
    Ligands AMP (ADENOSINE) x 3;PO4 (PHOSPHATE) x 7
    Metals

    Jmol

     
    Google Scholar output for 3dah

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch