.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d6b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.2 A crystal structure of glutaryl-CoA dehydrogenase from Burkholderia pseudomallei. To be Published
    Site NON-SSGCID
    PDB Id 3d6b Target Id BupsA.00027.a
    Molecular Characteristics
    Source Burkholderia pseudomallei
    Alias Ids TPS14943, BURPS1710B_3237 Molecular Weight 43114.98 Da.
    Residues 395 Isoelectric Point 5.85
    Sequence MAAATFHWDDPLLLDQQLADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQYGGPG LDYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLPKLATGEWIGCFGLTEPNHGSDPGSMV TRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLDEDGRDEIRGFILEKGCKGLSAPAIHGKVGLRASITGEIVL DEAFVPEENILPHVKGLRGPFTCLNSARYGIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQT EITLGLQGVLRLGRMKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVNTYEGT HDIHALILGRAQTGIQAFF
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.21 Rfree 0.261
    Matthews' coefficent 2.21 Rfactor 0.209
    Waters 500 Solvent Content 44.39

    Ligand Information
    Ligands 54D (METHYL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3d6b

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch