.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d63

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of inorganic pyrophosphatase from Burkholderia pseudomallei. To be Published
    Site NON-SSGCID
    PDB Id 3d63 Target Id BupsA.00023.a
    Molecular Characteristics
    Source Burkholderia pseudomallei
    Alias Ids TPS14940, PPA, BURPS1710B_1237 Molecular Weight 19160.13 Da.
    Residues 175 Isoelectric Point 5.37
    Sequence MSFSNVPAGKDLPQDFNVIIEIPAQSEPVKYEADKALGLLVVDRFIGTGMRYPVNYGFIPQTLSGDGDPVDVLVIT PFPLLAGSVVRARALGMLKMTDESGVDAKLVAVPHDKVCPMTANLKSIDDVPAYLKDQIKHFFEQYKALEKGKWV KVEGWDGIDAAHKEITDGVANFKK
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.29995
    Matthews' coefficent 2.85 Rfactor 0.23087
    Waters 240 Solvent Content 56.86

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d63

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch