.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d5t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Malate Dehydrogenase from Burkholderia pseudomallei. To be Published
    Site NON-SSGCID
    PDB Id 3d5t Target Id BupsA.00005.a
    Molecular Characteristics
    Source Burkholderia pseudomallei
    Alias Ids TPS14935, MDH, BURPS1710B_A0795 Molecular Weight 35013.27 Da.
    Residues 327 Isoelectric Point 5.70
    Sequence MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLPQAQAAVKGVVMELDDCAFPLLAGVVITDDPK VAFKDADVALLVGARPRSKGMERKDLLSANAEIFTVQGAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLPKK NFTAMLRLDHNRALSQLAAKSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLINDDVWNRDTFIPTVGK RGAAIIEARGLSSAASAANAAIDHVRDWVLGTNGKWVTMGIPSDGSYGIPEDIIYGVPVICENGEYKRVEGLEID AFSREKMDGTLAELLEERDGVAHLLK
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.51 Rfree 0.241
    Matthews' coefficent 2.41 Rfactor 0.178
    Waters 427 Solvent Content 49.05

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3d5t

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch