.
The Open Protein Structure Annotation Network
PDB Keyword
.

2c2i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and Function of Rv0130, a Conserved Hypothetical Protein from Mycobacterium Tuberculosis. Protein Sci. 15 2300 2006
    Site SPINE
    PDB Id 2c2i Target Id rv0130
    Molecular Characteristics
    Source M. tuberculosis
    Alias Ids TPS23982, Molecular Weight 15875.16 Da.
    Residues 150 Isoelectric Point 5.77
    Sequence rtfesvadlaaaagekvgqsdwvtitqeevnlfadatgdhqwihvdperaaagpfgttiahgfmtlall prlqhqmytvkgvklainyglnkvrfpapvpvgsrvratsslvgvedlgngtvqatvsttvevegsakp acvaesivryva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.8 Rfree 0.226
    Matthews' coefficent 2.5 Rfactor 0.183
    Waters 393 Solvent Content 50.6

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2c2i

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch