The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and Mechanism of the Alkyl Hydroperoxidase Ahpc, a Key Element of the Mycobacterium Tuberculosis Defense System Against Oxidative Stress. J.Biol.Chem. 280 25735 2005
    Site SPINE
    PDB Id 2bmx Target Id IPRv2428PALZ
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS23968,Q57348 Molecular Weight 21565.06 Da.
    Residues 195 Isoelectric Point 4.50
    Sequence mplltigdqfpayqltaliggdlskvdakqpgdyfttitsdehpgkwrvvffwpkdftfvcpteiaafs klndefedrdaqilgvsidsefahfqwraqhndlktlpfpmlsdikrelsqaagvlnadgvadrvtfiv dpnneiqfvsatagsvgrnvdevlrvldalqsdelcacnwrkgdptldagellkasa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.236
    Matthews' coefficent 2.9 Rfactor 0.195
    Waters 284 Solvent Content 57

    Ligand Information


    Google Scholar output for 2bmx

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch