.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bdi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of human tissue kallikrein 4: activity modulation by a specific zinc binding site. J.Mol.Biol. 362 1094-1107 2006
    Site SPINE
    PDB Id 2bdi Target Id MPIB-209
    Related PDB Ids 2bdg 2bdh 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23909,Q9Y5K2 Molecular Weight 27021.19 Da.
    Residues 254 Isoelectric Point 4.71
    Sequence matagnpwgwflgylilgvagslvsgscsqiingedcsphsqpwqaalvmenelfcsgvlvhpqwvlsa ahcfqnsytiglglhsleadqepgsqmveaslsvrhpeynrpllandlmlikldesvsesdtirsisia sqcptagnsclvsgwgllangrmptvlqcvnvsvvseevcsklydplyhpsmfcagggqdqkdscngds ggplicngylqglvsfgkapcgqvgvpgvytnlckftewiektvqas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 16
    Resolution (Å) 3.00 Rfree 0.296
    Matthews' coefficent 2.14 Rfactor 0.258
    Waters 456 Solvent Content 42.46

    Ligand Information
    Ligands PBZ (P-AMINO) x 16
    Metals CO (COBALT) x 4

    Jmol

     
    Google Scholar output for 2bdi

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch