.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zt4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of human CD1d with and without alpha-galactosylceramide. Nat.Immunol. 6 819-826 2005
    Site SPINE
    PDB Id 1zt4 Target Id CD1d_cell_surface_antigen
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23818, Molecular Weight 33088.02 Da.
    Residues 293 Isoelectric Point 7.00
    Sequence mgcllflllwallqawgsaevpqrlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslk pwsqgtfsdqqwetlqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqg kdilsfqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkkqvkpka wlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetwylratldvvageaag lscrvkhsslegqdivl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.326
    Matthews' coefficent 2.60 Rfactor 0.234
    Waters 18 Solvent Content 53.00

    Ligand Information
    Ligands AGH (N-{(1S,2R,3S)-1-[(ALPHA-D-GALACTOPYRANOSYLOXY)METHYL]-) x 1
    Metals

    Jmol

     
    Google Scholar output for 1zt4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch