.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zj8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Siroheme- and [Fe4-S4]-dependent NirA from Mycobacterium tuberculosis Is a Sulfite Reductase with a Covalent Cys-Tyr Bond in the Active Site. J.Biol.Chem. 280 27319-27328 2005
    Site SPINE
    PDB Id 1zj8 Target Id Mtb1
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS23836,AAK46756 Molecular Weight 62108.19 Da.
    Residues 555 Isoelectric Point 6.02
    Sequence mttarpakarnegqwalghreplnaneelkkagnpldvrerieniyakqgfdsidktdlrgrfrwwgly tqreqgydgtwtgddnidkleakyfmmrvrcdggalsaaalrtlgqistefardtadisdrqnvqyhwi evenvpeiwrrlddvglqtteacgdcprvvlgsplagesldevldptwaieeivrryigkpdfadlprk yktaisglqdvaheindvafigvnhpehgpgldlwvggglstnpmlaqrvgawvplgevpevwaavtsv frdygyrrlrakarlkflikdwgiakfrevleteylkrplidgpapepvkhpidhvgvqrlknglnavg vapiagrvsgtiltavadlmaragsdrirftpyqklvildipdallddliagldalglqsrpshwrrnl macsgiefcklsfaetrvraqhlvpelerrledinsqldvpitvningcpnscariqiadigfkgqmid dghggsvegfqvhlgghlgldagfgrklrqhkvtsdelgdyidrvvrnfvkhrsegerfaqwviraeeddlr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.29203
    Matthews' coefficent 2.30 Rfactor 0.21469
    Waters 22 Solvent Content 45.70

    Ligand Information
    Ligands SF4 (IRON/SULFUR) x 2;SRM (SIROHEME) x 2
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 1zj8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch