.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ym3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and function of carbonic anhydrases from Mycobacterium tuberculosis. J.Biol.Chem. 280 18782-18789 2005
    Site SPINE
    PDB Id 1ym3 Target Id Rv3588
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS23978, Molecular Weight 21790.54 Da.
    Residues 207 Isoelectric Point 5.60
    Sequence mpntnpvaawkalkegnerfvagrpqhpsqsvdhraglaagqkptavifgcadsrvaaeiifdqglgdm fvvrtaghvidsavlgsieyavtvlnvplivvlghdscgavnaalaaindgtlpggyvrdvvervapsv llgrrdglsrvdefeqrhvhetvailmarssaiseriaggslaivgvtyqlddgravlrdhignigeev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.22946
    Matthews' coefficent 1.90 Rfactor 0.17876
    Waters 130 Solvent Content 34.70

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1;ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1ym3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch