.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ylk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and function of carbonic anhydrases from Mycobacterium tuberculosis. J.Biol.Chem. 280 18782-18789 2005
    Site TBSGC
    PDB Id 1ylk Target Id Rv1284
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS23976,15608424, P64797, 15608424, NP_215800.1 Molecular Weight 18187.79 Da.
    Residues 163 Isoelectric Point 5.48
    Sequence mtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnagcvvtddvir slaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesypdavedvrqslrrievnp fvtkhtslrgfvfdvatgklnevtp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.22645
    Matthews' coefficent 2.00 Rfactor 0.18082
    Waters 268 Solvent Content 37.40

    Ligand Information
    Ligands SCN (THIOCYANATE) x 5
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 1ylk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch