.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yjr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A. J.Mol.Biol. 352 409-417 2005
    Site SPINE
    PDB Id 1yjr Target Id CIRMMP29
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23957,NP_000043 Molecular Weight 7831.71 Da.
    Residues 72 Isoelectric Point 7.07
    Sequence gdgvlelvvrgmtcascvhkiessltkhrgilycsvalatnkahikydpeiigprdiihtieslgfeps lvk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yjr

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch