The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for the cell-specific activities of the NGFI-B and the Nurr1 ligand-binding domain. J.Biol.Chem. 280 19250-19258 2005
    Site SPINE
    PDB Id 1yje Target Id IGBMC-1013-000
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23897,P22736 Molecular Weight 64459.54 Da.
    Residues 598 Isoelectric Point 6.82
    Sequence mpciqaqygtpapspgprdhlasdpltpefikptmdlaspeaapaaptalpsfstfmdgytgefdtfly qlpgtvqpcssasssasstssssatspasasfkfedfqvygcypgplsgpvdealsssgsdyygspcsa pspstpsfqppqlspwdgsfghfspsqtyeglrawteqlpkasgppqppaffsfspptgpspslaqspl klfpsqathqlgegesysmptafpglaptsphlegsgildtpvtstkarsgapggsegrcavcgdnasc qhygvrtcegckgffkrtvqknakyiclankdcpvdkrrrnrcqfcrfqkclavgmvkevvrtdslkgr rgrlpskpkqppdaspanlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgsl evirkwaekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfgdwi dsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehvaavagepqpascl srllgklpelrtlctqglqrifylkledlvppppiidkifmdtlpf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.278
    Matthews' coefficent 2.86 Rfactor 0.243
    Waters 69 Solvent Content 43.50

    Ligand Information


    Google Scholar output for 1yje

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch