The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conformational variability of matrix metalloproteinases: Beyond a single 3D structure. Proc.Natl.Acad.Sci.Usa 102 5334-5339 2005
    Site SPINE
    PDB Id 1ycm Target Id CIRMMP48
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23966,MM12_HUMAN, AAW29944 Molecular Weight 17591.78 Da.
    Residues 159 Isoelectric Point 6.10
    Sequence mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfargahgddha fdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslglghssdpkavmfptyky vdintfrlsaddirgiqslyg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2;CA (CALCIUM) x 3


    Google Scholar output for 1ycm

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch