.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y3j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title An NMR study of the interaction between the human copper(I) chaperone and the second and fifth metal-binding domains of the Menkes protein. Febs J. 272 865-871 2005
    Site SPINE
    PDB Id 1y3j Target Id CIRMMP26
    Related PDB Ids 1y3k 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23948,NP_000043 Molecular Weight 8021.90 Da.
    Residues 73 Isoelectric Point 6.39
    Sequence nsskcyiqvtgmtcascvaniernlrreegiysilvalmagkaevrynpaviqppmiaefirelgfgat vien
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals CU (COPPER) x 1

    Jmol

     
    Google Scholar output for 1y3j

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch