.
The Open Protein Structure Annotation Network
PDB Keyword
.

1w6v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the Human Ubiquitin-Specific Protease 15 Dusp Domain. J.Biol.Chem. 281 5026 2006
    Site SPINE
    PDB Id 1w6v Target Id BCBRA016
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23848,Q9Y5B5 Molecular Weight 13962.06 Da.
    Residues 121 Isoelectric Point 4.69
    Sequence mmaeggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnvypgpidns gllkdgdaqslkehlideldyillptegwnklvswytlmegqepiarkvveq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1w6v

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch