.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uwy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Human Carboxypeptidase M, a Membrane-Bound Enzyme that Regulates Peptide Hormone Activity. J.Mol.Biol. 338 257 2004
    Site SPINE
    PDB Id 1uwy Target Id MPIB-427
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23911,P14384 Molecular Weight 50511.28 Da.
    Residues 443 Isoelectric Point 6.94
    Sequence mdfpclwlglllplvaaldfnyhrqegmeaflktvaqnyssvthlhsigksvkgrnlwvlvvgrfpkeh rigipefkyvanmhgdetvgrelllhlidylvtsdgkdpeitnlinstrihimpsmnpdgfeavkkpdc yysigrenynqydlnrnfpdafeynnvsrqpetvavmkwlktetfvlsanlhggalvasypfdngvqat galysrsltpdddvfqylahtyasrnpnmkkgdecknkmnfpngvtngyswyplqggmqdynyiwaqcf eitlelscckypreeklpsfwnnnkaslieyikqvhlgvkgqvfdqngnplpnvivevqdrkhicpyrt nkygeyyllllpgsyiinvtvpghdphitkviipeksqnfsalkkdillpfqgqldsipvsnpscpmip lyrnlpdhsaatkpslflflvsllhiffk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.0 Rfree 0.286
    Matthews' coefficent 3.37 Rfactor 0.206
    Waters 25 Solvent Content

    Ligand Information
    Ligands NAG-NAG (N-ACETYL-D-GLUCOSAMINE) x 1
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1uwy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch