.
The Open Protein Structure Annotation Network
PDB Keyword
.

1usl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase Has a Known Fold, But a Novel Active Site. J.Mol.Biol. 335 799 2004
    Site SPINE
    PDB Id 1usl Target Id rv2465c
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS23974,BX842579 Molecular Weight 17276.55 Da.
    Residues 162 Isoelectric Point 6.14
    Sequence msgmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpgslgivlg gsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaealaivdafvttpwskaqrh qrridilaeyertheappvpgapa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 1.88 Rfree 0.20182
    Matthews' coefficent 2.8 Rfactor 0.16849
    Waters 579 Solvent Content 55.7

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 5
    Metals

    Jmol

     
    Google Scholar output for 1usl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch