The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the Apo and Copper(I)-Loaded Human Metallochaperone HAH1. Biochemistry 43 13046-13053 2004
    Site SPINE
    PDB Id 1tl5 Target Id CIRMMP27
    Related PDB Ids 1tl4 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23951,ATOX_HUMAN Molecular Weight 7401.24 Da.
    Residues 68 Isoelectric Point 6.71
    Sequence mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgktvsylgle
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1tl5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch