.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sjw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the polyketide cyclase SnoaL reveals a novel mechanism for enzymatic aldol condensation. Embo J. 23 1911-1921 2004
    Site SPINE
    PDB Id 1sjw Target Id ST_3
    Molecular Characteristics
    Source Streptomyces nogalater
    Alias Ids TPS23843,AAF01813 Molecular Weight 15504.65 Da.
    Residues 134 Isoelectric Point 5.64
    Sequence mvsafntgrtddvdeyihpdylnpatlehgihtgpkafaqlvgwvratfseearleevrieergpwvka ylvlygrhvgrlvgmpptdrrfsgeqvhlmrivdgkirdhrdwpdfqgtlrqlgdpwpddegwrp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.176
    Matthews' coefficent 2.16 Rfactor 0.143
    Waters 125 Solvent Content 42.74

    Ligand Information
    Ligands NGV (METHYL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1sjw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch