The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structures of a Cyanobacterial Metallochaperone: INSIGHT INTO AN ATYPICAL COPPER-BINDING MOTIF. J.Biol.Chem. 279 27502-27510 2004
    Site SPINE
    PDB Id 1sb6 Target Id CIRMMP34
    Molecular Characteristics
    Source Synechocystis sp. pcc 6803
    Alias Ids TPS23961,NP_440560 Molecular Weight 6685.18 Da.
    Residues 64 Isoelectric Point 4.58
    Sequence mtiqltvptiaceacaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasagheve
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1sb6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch