The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure and Backbone Dynamics of the Cu(I) and Apo Forms of the Second Metal-Binding Domain of the Menkes Protein ATP7A. Biochemistry 43 3396-3403 2004
    Site SPINE
    PDB Id 1s6u Target Id CIRMMP25
    Related PDB Ids 1s6o 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23946,NP_000043 Molecular Weight 8446.58 Da.
    Residues 76 Isoelectric Point 8.66
    Sequence gevvlkmkvegmtchsctstiegkigklqgvqrikvsldnqeativyqphlisveemkkqieamgfpaf vkkiegr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals CU1 (COPPER) x 1


    Google Scholar output for 1s6u

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch