.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rk9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Paramagnetism-based refinement strategy for the solution structure of human alpha-parvalbumin. Biochemistry 43 5562-5573 2004
    Site SPINE
    PDB Id 1rk9 Target Id CIRMMP07
    Related PDB Ids 1rjv 
    Molecular Characteristics
    Source Homo sapiens (human)
    Alias Ids TPS23934,P20472 Molecular Weight 12058.09 Da.
    Residues 110 Isoelectric Point 4.98
    Sequence msmtdllnaedikkavgafsatdsfdhkkffqmvglkkksaddvkkvfhmldkdksgfieedelgfilk gfspdardlsaketkmlmaagdkdgdgkigvdefstlvaes
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 1rk9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch