The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural adaptability in the ligand-binding pocket of the ecdysone hormone receptor. Nature 426 91-96 2003
    Site SPINE
    PDB Id 1r20 Target Id IGBMC-0091-000
    Related PDB Ids 1r1k 1g2n 
    Molecular Characteristics
    Source Choristoneura fumiferana
    Alias Ids TPS23884,HVUSP.EMBL Molecular Weight 56801.58 Da.
    Residues 505 Isoelectric Point 8.53
    Sequence irheitsrtsvsvlvnrcnwfctspkcsgltvmgclcvamsvakkdkptmsvtalinwarplppgqqqq pmtptspgnmlqpmatpsnlptvdcsldiqwlnleggfmspmsppemkpdtamldglrddstpppafkn yppnhplsgskhlcsicgdrasgkhygvyscegckgffkrtvrkdltyacreernciidkrqrnrcqyc ryqkclacgmkreavqeerqraargtedahpsssvqvqelsierllemeslvadpseefqflrvgpdsn vppkfrapvsslcqignkqiaalvvwardiphfsqlemedqillikgswnelllfaiawrsmeflteer dgvdgtgnrttsppqlmclmpgmtlhrnsalqagvgqifdrvlselslkmrtlrvdqaeyvalkaiill npdvkglknrqevevlrekmflcldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvadt siagyirdalrnhappidtnmm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.289
    Matthews' coefficent 3.27 Rfactor 0.244
    Waters 11 Solvent Content 62.38

    Ligand Information


    Google Scholar output for 1r20

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch