.
The Open Protein Structure Annotation Network
PDB Keyword
.

1qku

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Mutant Heralpha Ligand-Binding Domain Reveals Key Structural Features for the Mechanism of Partial Agonism. J.Biol.Chem. 276 15059 2001
    Site SPINE
    PDB Id 1qku Target Id IGBMC-0005-000
    Related PDB Ids 1g50 1qkt 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23870,P03372 Molecular Weight 66254.56 Da.
    Residues 595 Isoelectric Point 8.30
    Sequence mtmtlhtkasgmallhqiqgneleplnrpqlkiplerplgevyldsskpavynypegaayefnaaaaan aqvygqtglpygpgseaaafgsnglggfpplnsvspsplmllhpppqlspflqphgqqvpyylenepsg ytvreagppafyrpnsdnrrqggrerlastndkgsmamesaketrycavcndyasgyhygvwscegcka ffkrsiqghndymcpatnqctidknrrkscqacrlrkcyevgmmkggirkdrrggrmlkhkrqrddgeg rgevgsagdmraanlwpsplmikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmgl ltnladrelvhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpvkllfapnllldrnq gkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahrlhap tsrggasveetdqshlatagstsshslqkyyitgeaegfpatv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 3.2 Rfree 0.275
    Matthews' coefficent Rfactor 0.216
    Waters 596 Solvent Content 45

    Ligand Information
    Ligands EST (ESTRADIOL) x 3
    Metals

    Jmol

     
    Google Scholar output for 1qku

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch