.
The Open Protein Structure Annotation Network
PDB Keyword
.

1p6t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for the function of the N-terminal domain of the ATPase CopA from Bacillus subtilis. J.Biol.Chem. 278 50506-50513 2003
    Site SPINE
    PDB Id 1p6t Target Id CIRMMP06
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS23930,7428307 Molecular Weight 15924.38 Da.
    Residues 147 Isoelectric Point 5.03
    Sequence mlseqkeiamqvsgmtcaacaariekglkrmpgvtdanvnlatetvnviydpaetgtaaiqekieklgy hvvtekaefdiegmtcaacanriekrlnkiegvanapvnfaletvtveynpkeasvsdlkeavdklgyk lklkgeqds
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1p6t

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch