.
The Open Protein Structure Annotation Network
PDB Keyword
.

1p6q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the inactive and BeF3-activated response regulator CheY2. J.Mol.Biol. 338 287-297 2004
    Site SPINE
    PDB Id 1p6q Target Id 1
    Related PDB Ids 1p6u 
    Molecular Characteristics
    Source Sinorhizobium meliloti
    Alias Ids TPS23852,Q52884 Molecular Weight 13707.45 Da.
    Residues 129 Isoelectric Point 9.52
    Sequence mslaekikvlivddqvtsrlllgdalqqlgfkqitaagdgeqgmkimaqnphhlvisdfnmpkmdglgl lqavranpatkkaafiiltaqgdralvqkaaalgannvlakpftiekmkaaieavfgalk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1p6q

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch