.
The Open Protein Structure Annotation Network
PDB Keyword
.

1oq3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A core mutation affecting the folding properties of a soluble domain of the ATPase protein CopA from Bacillus subtilis. J.Mol.Biol. 331 473-484 2003
    Site SPINE
    PDB Id 1oq3 Target Id CIRMMP05
    Related PDB Ids 1oq6 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS23928,7428307 Molecular Weight 8165.01 Da.
    Residues 76 Isoelectric Point 5.27
    Sequence mlseqkeiamqvsgmtcaacaariekglkrmpgvtdanvnlatetvnviydpaetgtaaiqekieklgy hvviegr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1oq3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch