.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o6e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the Epstein-Barr Virus Protease Shows Rearrangement of the Processed C Terminus. J.Mol.Biol. 324 89 2002
    Site SPINE
    PDB Id 1o6e Target Id P6-000-000-014
    Molecular Characteristics
    Source Human herpes virus 4
    Alias Ids TPS23865,P03234 Molecular Weight 25392.51 Da.
    Residues 235 Isoelectric Point 5.88
    Sequence mvqapsvyvcgfverpdappkdaclhldpltvksqlplkkplpltvehlpdapvgsvfglyqssaglfs aasitsgdflslldsiyhdcdiaqsqrlplprepkvealhawlpslslaslhpdipqttadggklsffd hvsicalgrrrgttavygtdlawvlkhfsdlepsiaaqiendanaakresgcpedhplpltkliakaid agflrnrvetlrqdrgvanipaesylka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.273
    Matthews' coefficent 2.57 Rfactor 0.197
    Waters 12 Solvent Content 52

    Ligand Information
    Ligands ISP (PHOSPHORYLISOPROPANE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1o6e

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch