.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lbd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the ligand-binding domain of the human nuclear receptor RXR-alpha. Nature 375 377-382 1995
    Site SPINE
    PDB Id 1lbd Target Id IGBMC-0017-000
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23876,P19793 Molecular Weight 50808.53 Da.
    Residues 462 Isoelectric Point 7.92
    Sequence mdtkhflpldfstqvnssltsptgrgsmaapslhpslgpgigspgqlhspistlsspingmgppfsvis spmgphsmsvpttptlgfstgspqlsspmnpvsssedikpplglngvlkvpahpsgnmasftkhicaic gdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycryqkclamgmkreavqe erqrgkdrnenevestssanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkql ftlvewakriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgai fdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgr faklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.3230000
    Matthews' coefficent 3.10 Rfactor 0.2300000
    Waters Solvent Content 55.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1lbd

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch