The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and Functional Evidence for Ligand-Independent Transcriptional Activation by the Estrogen-Related Receptor 3. Mol.Cell 9 303-313 2002
    Site SPINE
    PDB Id 1kv6 Target Id IGBMC-0019-000
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23878,O75454 Molecular Weight 51303.20 Da.
    Residues 458 Isoelectric Point 6.04
    Sequence mdsvelclpesfslhyeeellcrmsnkdrhidsscssfiktepsspasltdsvnhhspggssdasgsys stmnghqngldspplypsapilggsgpvrklyddcsstivedpqtkceymlnsmpkrlclvcgdiasgy hygvasceackaffkrtiqgnieyscpatneceitkrrrkscqacrfmkclkvgmlkegvrldrvrggr qkykrridaenspylnpqlvqpakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrel vviigwakhipgfstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldl nnailqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.2674
    Matthews' coefficent 4.04 Rfactor 0.2328
    Waters 31 Solvent Content 69.30

    Ligand Information


    Google Scholar output for 1kv6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch