.
The Open Protein Structure Annotation Network
PDB Keyword
.

1g2n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects. J.Biol.Chem. 276 7465-7474 2001
    Site SPINE
    PDB Id 1g2n Target Id IGBMC-0091-000
    Related PDB Ids 1r1k 1r20 
    Molecular Characteristics
    Source Choristoneura fumiferana
    Alias Ids TPS23894,HVUSP.EMBL Molecular Weight 56801.58 Da.
    Residues 505 Isoelectric Point 8.53
    Sequence irheitsrtsvsvlvnrcnwfctspkcsgltvmgclcvamsvakkdkptmsvtalinwarplppgqqqq pmtptspgnmlqpmatpsnlptvdcsldiqwlnleggfmspmsppemkpdtamldglrddstpppafkn yppnhplsgskhlcsicgdrasgkhygvyscegckgffkrtvrkdltyacreernciidkrqrnrcqyc ryqkclacgmkreavqeerqraargtedahpsssvqvqelsierllemeslvadpseefqflrvgpdsn vppkfrapvsslcqignkqiaalvvwardiphfsqlemedqillikgswnelllfaiawrsmeflteer dgvdgtgnrttsppqlmclmpgmtlhrnsalqagvgqifdrvlselslkmrtlrvdqaeyvalkaiill npdvkglknrqevevlrekmflcldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvadt siagyirdalrnhappidtnmm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.2440000
    Matthews' coefficent 2.04 Rfactor 0.2100000
    Waters 259 Solvent Content 39.84

    Ligand Information
    Ligands EPH (L-ALPHA-PHOSPHATIDYL-BETA-OLEOYL-GAMMA-PALMITOYL-) x 1
    Metals

    Jmol

     
    Google Scholar output for 1g2n

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch